CDH23 antibody (70R-6179)

Rabbit polyclonal CDH23 antibody raised against the middle region of CDH23

Synonyms Polyclonal CDH23 antibody, Anti-CDH23 antibody, Cadherin-Like 23 antibody, FLJ00233 antibody, MGC102761 antibody, DFNB12 antibody, KIAA1812 antibody, USH1D antibody, DKFZp434P2350 antibody, KIAA1774 antibody, FLJ36499 antibody
Specificity CDH23 antibody was raised against the middle region of CDH23
Cross Reactivity Human,Mouse
Applications WB
Immunogen CDH23 antibody was raised using the middle region of CDH23 corresponding to a region with amino acids DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI
Assay Information CDH23 Blocking Peptide, catalog no. 33R-2240, is also available for use as a blocking control in assays to test for specificity of this CDH23 antibody

Images

Western Blot analysis using CDH23 antibody (70R-6179)

CDH23 antibody (70R-6179) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDH23 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is thought to be involved in stereocilia organization and hair bundle formation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CDH23 antibody (70R-6179) | CDH23 antibody (70R-6179) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors