CDH24 antibody (70R-6134)

Rabbit polyclonal CDH24 antibody raised against the N terminal of CDH24

Synonyms Polyclonal CDH24 antibody, Anti-CDH24 antibody, FLJ25193 antibody, Cadherin-Like 24 antibody, CDH11L antibody, MGC131880 antibody
Specificity CDH24 antibody was raised against the N terminal of CDH24
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CDH24 antibody was raised using the N terminal of CDH24 corresponding to a region with amino acids NPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDPSYGNSAKLVYTVLDG
Assay Information CDH24 Blocking Peptide, catalog no. 33R-6825, is also available for use as a blocking control in assays to test for specificity of this CDH24 antibody

Images

Western Blot analysis using CDH24 antibody (70R-6134)

CDH24 antibody (70R-6134) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 88 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDH24 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells, cadherins may thus contribute to the sorting of heterogeneous cell types. Cadherin-24 mediate strong cell-cell adhesion.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CDH24 antibody (70R-6134) | CDH24 antibody (70R-6134) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors