CDH4 antibody (70R-6192)

Rabbit polyclonal CDH4 antibody

Synonyms Polyclonal CDH4 antibody, Anti-CDH4 antibody, FLJ40547 antibody, RCAD antibody, Cadherin 4 Type 1 antibody, CAD4 antibody, MGC126700 antibody, FLJ22202 antibody, R-Cadherin antibody, MGC138355 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CDH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ENSRGPFPQQLVRIRSDKDNDIPIRYSITGVGADQPPMEVFSIDSMSGRM
Assay Information CDH4 Blocking Peptide, catalog no. 33R-2616, is also available for use as a blocking control in assays to test for specificity of this CDH4 antibody

Images

Western Blot analysis using CDH4 antibody (70R-6192)

CDH4 antibody (70R-6192) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 82 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDH4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDH4 gene is a classical cadherin from the cadherin superfamily. The protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Based on studies in chicken and mouse, this cadherin is thought to play an important role during brain segmentation and neuronal outgrowth. In addition, a role in kidney and muscle development is indicated. Of particular interest are studies showing stable cis-heterodimers of cadherins 2 and 4 in cotransfected cell lines. Previously thought to interact in an exclusively homophilic manner, this is the first evidence of cadherin heterodimerization.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CDH4 antibody (70R-6192) | CDH4 antibody (70R-6192) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors