CDH7 antibody (70R-6178)

Rabbit polyclonal CDH7 antibody raised against the N terminal of CDH7

Synonyms Polyclonal CDH7 antibody, Anti-CDH7 antibody, Cadherin 7 Type 2 antibody, CDH7L1 antibody
Specificity CDH7 antibody was raised against the N terminal of CDH7
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen CDH7 antibody was raised using the N terminal of CDH7 corresponding to a region with amino acids PKFLDGPYTAGVPEMSPVGTSVVQVTATDADDPTYGNSARVVYSILQGQP
Assay Information CDH7 Blocking Peptide, catalog no. 33R-7167, is also available for use as a blocking control in assays to test for specificity of this CDH7 antibody

Images

Western Blot analysis using CDH7 antibody (70R-6178)

CDH7 antibody (70R-6178) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 82 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDH7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDH7 is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CDH7 antibody (70R-6178) | CDH7 antibody (70R-6178) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors