CDH8 antibody (70R-6127)

Rabbit polyclonal CDH8 antibody raised against the middle region of CDH8

Synonyms Polyclonal CDH8 antibody, Anti-CDH8 antibody, Cadherin 8 Type 2 antibody, Nbla04261 antibody
Specificity CDH8 antibody was raised against the middle region of CDH8
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CDH8 antibody was raised using the middle region of CDH8 corresponding to a region with amino acids HENAALNSVIGQVTARDPDITSSPIRFSIDRHTDLERQFNINADDGKITL
Assay Information CDH8 Blocking Peptide, catalog no. 33R-3721, is also available for use as a blocking control in assays to test for specificity of this CDH8 antibody

Images

Immunohistochemical staining using CDH8 antibody (70R-6127)

CDH8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDH8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDH8 is a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using CDH8 antibody (70R-6127) | CDH8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using CDH8 antibody (70R-6127) | CDH8 antibody (70R-6127) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors