CDK5RAP1 antibody (70R-5660)

Rabbit polyclonal CDK5RAP1 antibody raised against the N terminal of CDK5RAP1

Synonyms Polyclonal CDK5RAP1 antibody, Anti-CDK5RAP1 antibody, C20orf34 antibody, Cdk5 Regulatory Subunit Associated Protein 1 antibody, CGI-05 antibody, CDK5RAP1.4 antibody, CDK5RAP1.3 antibody, C42 antibody, HSPC167 antibody
Specificity CDK5RAP1 antibody was raised against the N terminal of CDK5RAP1
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen CDK5RAP1 antibody was raised using the N terminal of CDK5RAP1 corresponding to a region with amino acids MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI
Assay Information CDK5RAP1 Blocking Peptide, catalog no. 33R-6227, is also available for use as a blocking control in assays to test for specificity of this CDK5RAP1 antibody


Western Blot analysis using CDK5RAP1 antibody (70R-5660)

CDK5RAP1 antibody (70R-5660) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDK5RAP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Neuronal CDC2-like kinase, which is involved in the regulation of neuronal differentiation, is composed of a catalytic subunit, CDK5, and an activating subunit, p25NCK5A.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CDK5RAP1 antibody (70R-5660) | CDK5RAP1 antibody (70R-5660) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors