CDR2 antibody (70R-1127)

Rabbit polyclonal CDR2 antibody raised against the N terminal of CDR2

Synonyms Polyclonal CDR2 antibody, Anti-CDR2 antibody, Cerebellar Degeneration-Related Protein 2 62Kda antibody, Yo antibody, CDR62 antibody
Specificity CDR2 antibody was raised against the N terminal of CDR2
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen CDR2 antibody was raised using the N terminal of CDR2 corresponding to a region with amino acids MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ
Assay Information CDR2 Blocking Peptide, catalog no. 33R-6176, is also available for use as a blocking control in assays to test for specificity of this CDR2 antibody


Immunohistochemical staining using CDR2 antibody (70R-1127)

CDR2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CDR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance cdr2 normally sequesters c-Myc in the neuronal cytoplasm, thereby down-regulating c-Myc activity, and suggest a mechanism whereby inhibition of cdr2 function by autoantibodies in PCD may contribute to Purkinje neuronal.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using CDR2 antibody (70R-1127) | CDR2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using CDR2 antibody (70R-1127) | CDR2 antibody (70R-1127) used at 5 ug/ml to detect target protein.
  • Immunohistochemical staining using CDR2 antibody (70R-1127) | CDR2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors