CDS1 antibody (70R-6397)

Rabbit polyclonal CDS1 antibody

Synonyms Polyclonal CDS1 antibody, Anti-CDS1 antibody, CDS antibody, Cdp-Diacylglycerol Synthase antibody, Phosphatidate Cytidylyltransferase 1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CDS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPF
Assay Information CDS1 Blocking Peptide, catalog no. 33R-9876, is also available for use as a blocking control in assays to test for specificity of this CDS1 antibody

Images

Western Blot analysis using CDS1 antibody (70R-6397)

CDS1 antibody (70R-6397) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. CDS1 is an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CDS1 antibody (70R-6397) | CDS1 antibody (70R-6397) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors