CDT1 antibody (70R-5537)

Rabbit polyclonal CDT1 antibody raised against the C terminal of CDT1

Synonyms Polyclonal CDT1 antibody, Anti-CDT1 antibody, RIS2 antibody, DUP antibody, Chromatin Licensing And Dna Replication Factor 1 antibody
Specificity CDT1 antibody was raised against the C terminal of CDT1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CDT1 antibody was raised using the C terminal of CDT1 corresponding to a region with amino acids PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ
Assay Information CDT1 Blocking Peptide, catalog no. 33R-6985, is also available for use as a blocking control in assays to test for specificity of this CDT1 antibody

Images

Western Blot analysis using CDT1 antibody (70R-5537)

CDT1 antibody (70R-5537) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDT1 cooperates with CDC6 to promote the loading of the mini-chromosome maintenance complex onto chromatin to form the pre-replication complex necessary to initiate DNA replication.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CDT1 antibody (70R-5537) | CDT1 antibody (70R-5537) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors