CDY1 antibody (70R-1047)

Rabbit polyclonal CDY1 antibody raised against the C terminal of CDY1

Synonyms Polyclonal CDY1 antibody, Anti-CDY1 antibody, CDY1A antibody, CDY antibody, Chromodomain Protein Y-Linked 1 antibody
Specificity CDY1 antibody was raised against the C terminal of CDY1
Cross Reactivity Human
Applications WB
Immunogen CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF
Assay Information CDY1 Blocking Peptide, catalog no. 33R-3023, is also available for use as a blocking control in assays to test for specificity of this CDY1 antibody


Western Blot analysis using CDY1 antibody (70R-1047)

CDY1 antibody (70R-1047) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CDY1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDY1 containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CDY1 antibody (70R-1047) | CDY1 antibody (70R-1047) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors