CEACAM16 antibody (70R-6430)

Rabbit polyclonal CEACAM16 antibody raised against the middle region of CEACAM16

Synonyms Polyclonal CEACAM16 antibody, Anti-CEACAM16 antibody, Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 antibody, CEAL2 antibody
Specificity CEACAM16 antibody was raised against the middle region of CEACAM16
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CEACAM16 antibody was raised using the middle region of CEACAM16 corresponding to a region with amino acids TVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNC
Assay Information CEACAM16 Blocking Peptide, catalog no. 33R-9368, is also available for use as a blocking control in assays to test for specificity of this CEACAM16 antibody


Western Blot analysis using CEACAM16 antibody (70R-6430)

CEACAM16 antibody (70R-6430) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CEACAM16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CEACAM16 is a single-pass type I membrane protein.It belongs to the immunoglobulin superfamily, CEA family.It contains 2 Ig-like C2-type (immunoglobulin-like) domains. The exact function of CEACAM16 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CEACAM16 antibody (70R-6430) | CEACAM16 antibody (70R-6430) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors