CEACAM19 antibody (70R-6300)

Rabbit polyclonal CEACAM19 antibody raised against the middle region of CEACAM19

Synonyms Polyclonal CEACAM19 antibody, Anti-CEACAM19 antibody, CEAL1 antibody, MGC105097 antibody, Carcinoembryonic Antigen-Related Cell Adhesion Molecule 19 antibody
Specificity CEACAM19 antibody was raised against the middle region of CEACAM19
Cross Reactivity Human
Applications WB
Immunogen CEACAM19 antibody was raised using the middle region of CEACAM19 corresponding to a region with amino acids MLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQVAEKNKELPSTHLPTNA
Assay Information CEACAM19 Blocking Peptide, catalog no. 33R-6194, is also available for use as a blocking control in assays to test for specificity of this CEACAM19 antibody

Images

Western Blot analysis using CEACAM19 antibody (70R-6300)

CEACAM19 antibody (70R-6300) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CEACAM19 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CEACAM protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CEACAM19 antibody (70R-6300) | CEACAM19 antibody (70R-6300) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors