CEACAM4 antibody (70R-7236)

Rabbit polyclonal CEACAM4 antibody raised against the N terminal of CEACAM4

Synonyms Polyclonal CEACAM4 antibody, Anti-CEACAM4 antibody, CGM7_HUMAN antibody, CGM7 antibody, NCA antibody, Carcinoembryonic Antigen-Related Cell Adhesion Molecule 4 antibody
Specificity CEACAM4 antibody was raised against the N terminal of CEACAM4
Cross Reactivity Human
Applications WB
Immunogen CEACAM4 antibody was raised using the N terminal of CEACAM4 corresponding to a region with amino acids FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITD
Assay Information CEACAM4 Blocking Peptide, catalog no. 33R-3092, is also available for use as a blocking control in assays to test for specificity of this CEACAM4 antibody

Images

Western Blot analysis using CEACAM4 antibody (70R-7236)

CEACAM4 antibody (70R-7236) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CEACAM4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CEACAM4 belongs to the immunoglobulin superfamily.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CEACAM4 antibody (70R-7236) | CEACAM4 antibody (70R-7236) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors