CEACAM6 antibody (70R-1221)

Rabbit polyclonal CEACAM6 antibody

Synonyms Polyclonal CEACAM6 antibody, Anti-CEACAM6 antibody, CD66c antibody, Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 antibody, CEAL antibody, NCA antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP
Assay Information CEACAM6 Blocking Peptide, catalog no. 33R-2483, is also available for use as a blocking control in assays to test for specificity of this CEACAM6 antibody

Images

Immunohistochemical staining using CEACAM6 antibody (70R-1221)

CEACAM6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CEACAM6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo. CEACAM6 expression is elevated in many solid tumors, but variable as a function of histotype. It may be a promising target for antibody-based therapy.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using CEACAM6 antibody (70R-1221) | CEACAM6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
  • Western Blot analysis using CEACAM6 antibody (70R-1221) | CEACAM6 antibody (70R-1221) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors