CECR1 antibody (70R-6242)

Rabbit polyclonal CECR1 antibody raised against the N terminal of CECR1

Synonyms Polyclonal CECR1 antibody, Anti-CECR1 antibody, Cat Eye Syndrome Chromosome Region Candidate 1 antibody, IDGFL antibody
Specificity CECR1 antibody was raised against the N terminal of CECR1
Cross Reactivity Human
Applications WB
Immunogen CECR1 antibody was raised using the N terminal of CECR1 corresponding to a region with amino acids MQFRFAHPTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHP
Assay Information CECR1 Blocking Peptide, catalog no. 33R-6325, is also available for use as a blocking control in assays to test for specificity of this CECR1 antibody

Images

Western Blot analysis using CECR1 antibody (70R-6242)

CECR1 antibody (70R-6242) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CECR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CECR1 a member of a subfamily of the adenosine deaminase protein family. It may act as a growth factor and have adenosine deaminase activity. This gene may be responsible for some of the phenotypic features associated with cat eye syndrome. Two transcript variants encoding distinct isoforms have been identified for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CECR1 antibody (70R-6242) | CECR1 antibody (70R-6242) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors