CEND1 antibody (70R-6482)

Rabbit polyclonal CEND1 antibody raised against the N terminal of CEND1

Synonyms Polyclonal CEND1 antibody, Anti-CEND1 antibody, FLJ90066 antibody, MGC34326 antibody, BM88 antibody, Cell Cycle Exit And Neuronal Differentiation 1 antibody
Specificity CEND1 antibody was raised against the N terminal of CEND1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CEND1 antibody was raised using the N terminal of CEND1 corresponding to a region with amino acids MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQ
Assay Information CEND1 Blocking Peptide, catalog no. 33R-5964, is also available for use as a blocking control in assays to test for specificity of this CEND1 antibody


Western Blot analysis using CEND1 antibody (70R-6482)

CEND1 antibody (70R-6482) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CEND1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CEND1 is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. The protein encoded by this gene is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. Multiple pseudogenes have been reported for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CEND1 antibody (70R-6482) | CEND1 antibody (70R-6482) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors