CENPI antibody (70R-3284)

Rabbit polyclonal CENPI antibody raised against the N terminal of CENPI

Synonyms Polyclonal CENPI antibody, Anti-CENPI antibody, LRPR1 antibody, FSHPRH1 antibody, Centromere Protein I antibody, CENP-I antibody, Mis6 antibody
Specificity CENPI antibody was raised against the N terminal of CENPI
Cross Reactivity Human
Applications WB
Immunogen CENPI antibody was raised using the N terminal of CENPI corresponding to a region with amino acids SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV
Assay Information CENPI Blocking Peptide, catalog no. 33R-8690, is also available for use as a blocking control in assays to test for specificity of this CENPI antibody

Images

Western Blot analysis using CENPI antibody (70R-3284)

CENPI antibody (70R-3284) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 87 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CENPI antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CENPI is involved in the response of gonadal tissues to follicle-stimulating hormone. The gene encoding CENPI is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis. The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CENPI antibody (70R-3284) | CENPI antibody (70R-3284) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors