CENTG1 antibody (70R-3491)

Rabbit polyclonal CENTG1 antibody raised against the middle region of CENTG1

Synonyms Polyclonal CENTG1 antibody, Anti-CENTG1 antibody, KIAA0167 antibody, PIKE antibody, FLJ16430 antibody, AGAP2 antibody, Arfgap With Gtpase Domain Ankyrin Repeat And Ph Domain 2 antibody, GGAP2 antibody
Specificity CENTG1 antibody was raised against the middle region of CENTG1
Cross Reactivity Human
Applications WB
Immunogen CENTG1 antibody was raised using the middle region of CENTG1 corresponding to a region with amino acids AHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQG
Assay Information CENTG1 Blocking Peptide, catalog no. 33R-1240, is also available for use as a blocking control in assays to test for specificity of this CENTG1 antibody

Western Blot analysis using CENTG1 antibody (70R-3491)

CENTG1 antibody (70R-3491) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 90 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CENTG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CENTG1 is a GTPase-activating protein (GAP) for ARF1 and ARF5, which also shows strong GTPase activity. Isoform 1 participates in the prevention of neuronal apoptosis by enhancing PI3 kinase activity. It aids the coupling of metabotropic glutamate receptor 1 (GRM1) to cytoplasmic PI3 kinase by interacting with Homer scaffolding proteins, and also seems to mediate anti-apoptotic effects of NGF by activating nuclear PI3 kinase. Isoform 2 does not stimulate PI3 kinase but may protect cells from apoptosis by stimulating Akt. It also regulates the adapter protein 1 (AP-1)-dependent trafficking of proteins in the endosomal system. It seems to be oncogenic. It is overexpressed in cancer cells, prevents apoptosis and promotes cancer cell invasion.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using CENTG1 antibody (70R-3491) | CENTG1 antibody (70R-3491) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors