CES3 Blocking Peptide (33R-10383)

A synthetic peptide for use as a blocking control in assays to test for specificity of CES3 antibody, catalog no. 70R-10409

Synonyms CES3 control peptide, CES3 antibody Blocking Peptide, Anti-CES3 Blocking Peptide, carboxylesterase 3 Blocking Peptide, ES31 Blocking Peptide, FLJ21736 Blocking Peptide, CES3, CES-3, CES 3, CES-3 Blocking Peptide, CES 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QAEQYLEINPVPRAGQKFREAWMQFWSETLPSKIQQWHQKQKNRKAQEDL
Molecular Weight 63 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This gene is expressed in several tissues, particularly in colon, trachea and in brain, and the protein participates in colon and neural drug metabolism. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported, but the biological validity and/or full-length nature of some variants have not been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors