CETP antibody (70R-5448)

Rabbit polyclonal CETP antibody raised against the N terminal of CETP

Synonyms Polyclonal CETP antibody, Anti-CETP antibody, Cholesteryl Ester Transfer Protein Plasma antibody
Specificity CETP antibody was raised against the N terminal of CETP
Cross Reactivity Human
Applications WB
Immunogen CETP antibody was raised using the N terminal of CETP corresponding to a region with amino acids ALLVLNHETAKVIQTAFQRASYPDITGEKAMMLLGQVKYGLHNIQISHLS
Assay Information CETP Blocking Peptide, catalog no. 33R-1358, is also available for use as a blocking control in assays to test for specificity of this CETP antibody


Western Blot analysis using CETP antibody (70R-5448)

CETP antibody (70R-5448) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CETP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CETP involved in the transfer of insoluble cholesteryl esters in the reverse transport of cholesterol. Defects in CETP are a cause of hyperalphalipoproteinemia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CETP antibody (70R-5448) | CETP antibody (70R-5448) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors