CFDP1 antibody (70R-4525)

Rabbit polyclonal CFDP1 antibody raised against the middle region of CFDP1

Synonyms Polyclonal CFDP1 antibody, Anti-CFDP1 antibody, p97 antibody, Craniofacial Development Protein 1 antibody, CP27 antibody, Yeti antibody, SWC5 antibody, BCNT antibody
Specificity CFDP1 antibody was raised against the middle region of CFDP1
Cross Reactivity Human
Applications WB
Immunogen CFDP1 antibody was raised using the middle region of CFDP1 corresponding to a region with amino acids GSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIH
Assay Information CFDP1 Blocking Peptide, catalog no. 33R-3561, is also available for use as a blocking control in assays to test for specificity of this CFDP1 antibody

Images

Western Blot analysis using CFDP1 antibody (70R-4525)

CFDP1 antibody (70R-4525) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CFDP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CFDP1 may play a role during embryogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CFDP1 antibody (70R-4525) | CFDP1 antibody (70R-4525) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors