CFP antibody (70R-5909)

Rabbit polyclonal CFP antibody raised against the middle region of CFP

Synonyms Polyclonal CFP antibody, Anti-CFP antibody, PROPERDIN antibody, Complement Factor Properdin antibody, PFC antibody, PFD antibody, BFD antibody
Specificity CFP antibody was raised against the middle region of CFP
Cross Reactivity Human
Applications WB
Immunogen CFP antibody was raised using the middle region of CFP corresponding to a region with amino acids SMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEE
Assay Information CFP Blocking Peptide, catalog no. 33R-8645, is also available for use as a blocking control in assays to test for specificity of this CFP antibody

Images

Western Blot analysis using CFP antibody (70R-5909)

CFP antibody (70R-5909) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CFP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CFP is a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CFP antibody (70R-5909) | CFP antibody (70R-5909) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors