CHAC1 antibody (70R-3936)

Rabbit polyclonal CHAC1 antibody

Synonyms Polyclonal CHAC1 antibody, Anti-CHAC1 antibody, Chac Cation Transport Regulator Homolog 1 antibody, MGC4504 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CHAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD
Assay Information CHAC1 Blocking Peptide, catalog no. 33R-9229, is also available for use as a blocking control in assays to test for specificity of this CHAC1 antibody


Western Blot analysis using CHAC1 antibody (70R-3936)

CHAC1 antibody (70R-3936) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHAC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHAC1 belongs to the chaC family. The exact function of CHAC1 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CHAC1 antibody (70R-3936) | CHAC1 antibody (70R-3936) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors