CHAF1B antibody (70R-5510)

Rabbit polyclonal CHAF1B antibody

Synonyms Polyclonal CHAF1B antibody, Anti-CHAF1B antibody, CAF1A antibody, CHAFB-1, MPP7 antibody, CHAFB-1 antibody, CHAFB 1 antibody, CAF-1 antibody, MPHOSPH7 antibody, Chromatin Assembly Factor 1 Subunit B antibody, CHAF1B, CAF-IP60 antibody, CHAFB 1, CAF1P60 antibody, P60 antibody, CAF1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CHAF1B antibody was raised using a synthetic peptide corresponding to a region with amino acids KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD
Assay Information CHAF1B Blocking Peptide, catalog no. 33R-4709, is also available for use as a blocking control in assays to test for specificity of this CHAF1B antibody


Western Blot analysis using CHAF1B antibody (70R-5510)

CHAF1B antibody (70R-5510) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHAF1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. CHAF1B corresponds to the p60 subunit and is required for chromatin assembly after replication. CHAF1B is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CHAF1B antibody (70R-5510) | CHAF1B antibody (70R-5510) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors