CHCHD3 antibody (70R-4356)

Rabbit polyclonal CHCHD3 antibody raised against the middle region of CHCHD3

Synonyms Polyclonal CHCHD3 antibody, Anti-CHCHD3 antibody, FLJ20420 antibody, Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 3 antibody
Specificity CHCHD3 antibody was raised against the middle region of CHCHD3
Cross Reactivity Human
Applications WB
Immunogen CHCHD3 antibody was raised using the middle region of CHCHD3 corresponding to a region with amino acids LRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFY
Assay Information CHCHD3 Blocking Peptide, catalog no. 33R-5354, is also available for use as a blocking control in assays to test for specificity of this CHCHD3 antibody


Western Blot analysis using CHCHD3 antibody (70R-4356)

CHCHD3 antibody (70R-4356) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHCHD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ChChd3 is an inner mitochondrial membrane protein and is essential for maintaining crista integrity and mitochondrial function.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CHCHD3 antibody (70R-4356) | CHCHD3 antibody (70R-4356) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors