CHD1L antibody (70R-1304)

Rabbit polyclonal CHD1L antibody raised against the middle region of CHD1L

Synonyms Polyclonal CHD1L antibody, Anti-CHD1L antibody, Chromodomain Helicase Dna Binding Protein 1-Like antibody
Specificity CHD1L antibody was raised against the middle region of CHD1L
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen CHD1L antibody was raised using the middle region of CHD1L corresponding to a region with amino acids DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL
Assay Information CHD1L Blocking Peptide, catalog no. 33R-1859, is also available for use as a blocking control in assays to test for specificity of this CHD1L antibody

Images

Western Blot analysis using CHD1L antibody (70R-1304)

CHD1L antibody (70R-1304) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CHD1L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHD1L encodes a protein that interacts with ADP-ribose. ADP-ribosylation of proteins is an important post-translational modification that occurs in a variety of biological processes, including DNA repair, transcription, chromatin biology and long-term memory formation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CHD1L antibody (70R-1304) | CHD1L antibody (70R-1304) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors