CHERP antibody (70R-5261)

Rabbit polyclonal CHERP antibody raised against the middle region of CHERP

Synonyms Polyclonal CHERP antibody, Anti-CHERP antibody, SRA1 antibody, DAN16 antibody, Calcium Homeostasis Endoplasmic Reticulum Protein antibody, SCAF6 antibody
Specificity CHERP antibody was raised against the middle region of CHERP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CHERP antibody was raised using the middle region of CHERP corresponding to a region with amino acids EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD
Assay Information CHERP Blocking Peptide, catalog no. 33R-2664, is also available for use as a blocking control in assays to test for specificity of this CHERP antibody


Western Blot analysis using CHERP antibody (70R-5261)

CHERP antibody (70R-5261) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 104 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHERP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHERP is involved in calcium homeostasis, growth and proliferation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CHERP antibody (70R-5261) | CHERP antibody (70R-5261) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors