CHGN antibody (70R-6125)

Rabbit polyclonal CHGN antibody raised against the C terminal Of Chgn

Synonyms Polyclonal CHGN antibody, Anti-CHGN antibody, FLJ11264 antibody, beta4GalNAcT antibody
Specificity CHGN antibody was raised against the C terminal Of Chgn
Cross Reactivity Human,Mouse
Applications WB
Immunogen CHGN antibody was raised using the C terminal Of Chgn corresponding to a region with amino acids DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT
Assay Information CHGN Blocking Peptide, catalog no. 33R-1910, is also available for use as a blocking control in assays to test for specificity of this CHGN antibody

Images

Western Blot analysis using CHGN antibody (70R-6125)

CHGN antibody (70R-6125) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHGN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ChGn transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). This protein is required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains. It play an important role in chondroitin chain biosynthesis in cartilage.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CHGN antibody (70R-6125) | CHGN antibody (70R-6125) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors