CHI3L1 antibody (70R-5358)

Rabbit polyclonal CHI3L1 antibody

Synonyms Polyclonal CHI3L1 antibody, Anti-CHI3L1 antibody, YKL40 antibody, Cartilage Glycoprotein-39 antibody, YYL-40 antibody, HC-gp39 antibody, HCGP-3P antibody, FLJ38139 antibody, Chitinase 3-Like 1 antibody, DKFZp686N19119 antibody, GP39 antibody
Cross Reactivity Human
Applications WB
Immunogen CHI3L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL
Assay Information CHI3L1 Blocking Peptide, catalog no. 33R-4844, is also available for use as a blocking control in assays to test for specificity of this CHI3L1 antibody

Images

Western Blot analysis using CHI3L1 antibody (70R-5358)

CHI3L1 antibody (70R-5358) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHI3L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CHI3L1 antibody (70R-5358) | CHI3L1 antibody (70R-5358) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors