CHIA antibody (70R-5920)

Rabbit polyclonal CHIA antibody raised against the N terminal of CHIA

Synonyms Polyclonal CHIA antibody, Anti-CHIA antibody, DKFZp313J1722 antibody, AMCase antibody, TSA1902 antibody, CHIT2 antibody, Chitinase Acidic antibody, RP5-1125M8.1 antibody, 2200003E03Rik antibody
Specificity CHIA antibody was raised against the N terminal of CHIA
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CHIA antibody was raised using the N terminal of CHIA corresponding to a region with amino acids MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL
Assay Information CHIA Blocking Peptide, catalog no. 33R-6610, is also available for use as a blocking control in assays to test for specificity of this CHIA antibody

Images

Western Blot analysis using CHIA antibody (70R-5920)

CHIA antibody (70R-5920) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHIA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CHIA antibody (70R-5920) | CHIA antibody (70R-5920) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors