CHIA antibody (70R-5921)

Rabbit polyclonal CHIA antibody raised against the middle region of CHIA

Synonyms Polyclonal CHIA antibody, Anti-CHIA antibody, RP5-1125M8.1 antibody, CHIT2 antibody, DKFZp313J1722 antibody, AMCase antibody, Chitinase Acidic antibody, 2200003E03Rik antibody, TSA1902 antibody
Specificity CHIA antibody was raised against the middle region of CHIA
Cross Reactivity Human
Applications WB
Immunogen CHIA antibody was raised using the middle region of CHIA corresponding to a region with amino acids GSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFP
Assay Information CHIA Blocking Peptide, catalog no. 33R-3598, is also available for use as a blocking control in assays to test for specificity of this CHIA antibody

Images

Western Blot analysis using CHIA antibody (70R-5921)

CHIA antibody (70R-5921) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHIA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CHIA antibody (70R-5921) | CHIA antibody (70R-5921) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors