CHIC1 antibody (70R-1775)

Rabbit polyclonal CHIC1 antibody raised against the N terminal of CHIC1

Synonyms Polyclonal CHIC1 antibody, Anti-CHIC1 antibody, RP11-108A15.1 antibody, BRX antibody, DKFZp313P1931 antibody, DKFZp686F2342 antibody, Cysteine-Rich Hydrophobic Domain 1 antibody
Specificity CHIC1 antibody was raised against the N terminal of CHIC1
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen CHIC1 antibody was raised using the N terminal of CHIC1 corresponding to a region with amino acids LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRV
Assay Information CHIC1 Blocking Peptide, catalog no. 33R-5387, is also available for use as a blocking control in assays to test for specificity of this CHIC1 antibody

Images

Western Blot analysis using CHIC1 antibody (70R-1775)

CHIC1 antibody (70R-1775) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CHIC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CHIC protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CHIC1 antibody (70R-1775) | CHIC1 antibody (70R-1775) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors