CHIC2 antibody (70R-6863)

Rabbit polyclonal CHIC2 antibody raised against the N terminal of CHIC2

Synonyms Polyclonal CHIC2 antibody, Anti-CHIC2 antibody, BTL antibody, Cysteine-Rich Hydrophobic Domain 2 antibody, MGC21173 antibody
Specificity CHIC2 antibody was raised against the N terminal of CHIC2
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen CHIC2 antibody was raised using the N terminal of CHIC2 corresponding to a region with amino acids EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI
Assay Information CHIC2 Blocking Peptide, catalog no. 33R-2382, is also available for use as a blocking control in assays to test for specificity of this CHIC2 antibody

Images

Immunohistochemical staining using CHIC2 antibody (70R-6863)

CHIC2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHIC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHIC2 is a member of the CHIC family of proteins. This protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. CHIC2 gene is associated with some cases of acute myeloid leukemia.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using CHIC2 antibody (70R-6863) | CHIC2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using CHIC2 antibody (70R-6863) | CHIC2 antibody (70R-6863) used at 0.25 ug/ml to detect target protein.
  • Immunohistochemical staining using CHIC2 antibody (70R-6863) | CHIC2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors