CHKA antibody (70R-3628)

Rabbit polyclonal CHKA antibody raised against the middle region of CHKA

Synonyms Polyclonal CHKA antibody, Anti-CHKA antibody, CKI antibody, CHK antibody, Choline Kinase Alpha antibody
Specificity CHKA antibody was raised against the middle region of CHKA
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CHKA antibody was raised using the middle region of CHKA corresponding to a region with amino acids LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI
Assay Information CHKA Blocking Peptide, catalog no. 33R-4929, is also available for use as a blocking control in assays to test for specificity of this CHKA antibody

Images

Western Blot analysis using CHKA antibody (70R-3628)

CHKA antibody (70R-3628) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHKA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. CHKA is the initial enzyme in the sequence and may play a regulatory role. It also catalyzes the phosphorylation of ethanolamine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CHKA antibody (70R-3628) | CHKA antibody (70R-3628) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors