CHMP1B antibody (70R-4086)

Rabbit polyclonal CHMP1B antibody raised against the N terminal of CHMP1B

Synonyms Polyclonal CHMP1B antibody, Anti-CHMP1B antibody, CHMP1.5 antibody, C18-ORF2 antibody, Vps46-2 antibody, C10orf2 antibody, Chromatin Modifying Protein 1B antibody, C18orf2 antibody
Specificity CHMP1B antibody was raised against the N terminal of CHMP1B
Cross Reactivity Human
Applications WB
Immunogen CHMP1B antibody was raised using the N terminal of CHMP1B corresponding to a region with amino acids KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT
Assay Information CHMP1B Blocking Peptide, catalog no. 33R-4435, is also available for use as a blocking control in assays to test for specificity of this CHMP1B antibody


Western Blot analysis using CHMP1B antibody (70R-4086)

CHMP1B antibody (70R-4086) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHMP1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A, is required for both MVB formation and regulation of cell cycle progression.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CHMP1B antibody (70R-4086) | CHMP1B antibody (70R-4086) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors