CHMP4B antibody (70R-4493)

Rabbit polyclonal CHMP4B antibody raised against the middle region of CHMP4B

Synonyms Polyclonal CHMP4B antibody, Anti-CHMP4B antibody, SNF7 antibody, Shax1 antibody, CHMP4A antibody, Chromatin Modifying Protein 4B antibody, CTPP3 antibody, C20orf178 antibody, SNF7-2 antibody, dJ553F4.4 antibody
Specificity CHMP4B antibody was raised against the middle region of CHMP4B
Cross Reactivity Human
Applications WB
Immunogen CHMP4B antibody was raised using the middle region of CHMP4B corresponding to a region with amino acids RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH
Assay Information CHMP4B Blocking Peptide, catalog no. 33R-8000, is also available for use as a blocking control in assays to test for specificity of this CHMP4B antibody

Images

Western Blot analysis using CHMP4B antibody (70R-4493)

CHMP4B antibody (70R-4493) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHMP4B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein (CHMP) protein family. The protein is part of the endosomal sorting complex required for transport (ESCRT) complex III (ESCRT-III), which functions in the sorting of endocytosed cell-surface receptors into multivesicular endosomes. The ESCRT machinery also functions in the final abscisson stage of cytokinesis and in the budding of enveloped viruses such as HIV-1. The three proteins of the CHMP4 subfamily interact with programmed cell death 6 interacting protein (PDCD6IP, also known as ALIX), which also functions in the ESCRT pathway. The CHMP4 proteins assemble into membrane-attached 5-nm filaments that form circular scaffolds and promote or stabilize outward budding. These polymers are proposed to help generate the luminal vesicles of multivesicular bodies. Mutations in this gene result in autosomal dominant posterior polar cataracts.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CHMP4B antibody (70R-4493) | CHMP4B antibody (70R-4493) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors