CHN1 antibody (70R-5735)

Rabbit polyclonal CHN1 antibody

Synonyms Polyclonal CHN1 antibody, Anti-CHN1 antibody, CHN antibody, Chimaerin 1 antibody, ARHGAP2 antibody, RHOGAP2 antibody, Chimerin antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CHN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIE
Assay Information CHN1 Blocking Peptide, catalog no. 33R-4728, is also available for use as a blocking control in assays to test for specificity of this CHN1 antibody

Images

Western Blot analysis using CHN1 antibody (70R-5735)

CHN1 antibody (70R-5735) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHN1 contains 1 phorbol-ester/DAG-type zinc finger, 1 Rho-GAP domain and 1 SH2 domain. CHN1 is a GTPase-activating protein for p21-rac and a phorbol ester receptor. It may play an important role in neuronal signal-transduction mechanisms.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CHN1 antibody (70R-5735) | CHN1 antibody (70R-5735) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors