Chondroadherin antibody (70R-5471)

Rabbit polyclonal Chondroadherin antibody raised against the middle region of CHAD

Synonyms Polyclonal Chondroadherin antibody, Anti-Chondroadherin antibody, SLRR4A antibody, CHAD antibody
Specificity Chondroadherin antibody was raised against the middle region of CHAD
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Chondroadherin antibody was raised using the middle region of CHAD corresponding to a region with amino acids VDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWL
Assay Information Chondroadherin Blocking Peptide, catalog no. 33R-9477, is also available for use as a blocking control in assays to test for specificity of this Chondroadherin antibody


Western Blot analysis using Chondroadherin antibody (70R-5471)

Chondroadherin antibody (70R-5471) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHAD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Chondroadherin is a cartilage matrix protein thought to mediate adhesion of isolated chondrocytes. CHAD contains 11 leucine-rich repeats flanked by cysteine-rich regions. The chondroadherin messenger RNA is present in chondrocytes at all ages.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Chondroadherin antibody (70R-5471) | Chondroadherin antibody (70R-5471) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors