CHORDC1 antibody (70R-4225)

Rabbit polyclonal CHORDC1 antibody

Synonyms Polyclonal CHORDC1 antibody, Anti-CHORDC1 antibody, Chord-Containing 1 antibody, Cysteine And Histidine-Rich Domain antibody, CHP1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CHORDC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVP
Assay Information CHORDC1 Blocking Peptide, catalog no. 33R-8501, is also available for use as a blocking control in assays to test for specificity of this CHORDC1 antibody


Western Blot analysis using CHORDC1 antibody (70R-4225)

CHORDC1 antibody (70R-4225) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHORDC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHORDC1 may be play a role in the regulation of NOD1 via its interaction with HSP90AA1.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CHORDC1 antibody (70R-4225) | CHORDC1 antibody (70R-4225) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors