CHRFAM7A antibody (70R-5143)

Rabbit polyclonal CHRFAM7A antibody raised against the N terminal of CHRFAM7A

Synonyms Polyclonal CHRFAM7A antibody, Anti-CHRFAM7A antibody, Chrna7 antibody, Cholinergic Receptor Nicotinic Alpha 7 And Fam7A antibody
Specificity CHRFAM7A antibody was raised against the N terminal of CHRFAM7A
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen CHRFAM7A antibody was raised using the N terminal of CHRFAM7A corresponding to a region with amino acids QFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSC
Assay Information CHRFAM7A Blocking Peptide, catalog no. 33R-7550, is also available for use as a blocking control in assays to test for specificity of this CHRFAM7A antibody


Western Blot analysis using CHRFAM7A antibody (70R-5143)

CHRFAM7A antibody (70R-5143) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHRFAM7A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7 is located on chromosome 15 in a region associated with several neuropsychiatric disorders. CHRFAM7A is is a hybrid between CHRNA7 and FAM7A.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CHRFAM7A antibody (70R-5143) | CHRFAM7A antibody (70R-5143) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors