CHRNA5 antibody (70R-1529)

Rabbit polyclonal CHRNA5 antibody raised against the middle region of CHRNA5

Synonyms Polyclonal CHRNA5 antibody, Anti-CHRNA5 antibody, Cholinergic Receptor Nicotinic Alpha 5 antibody
Specificity CHRNA5 antibody was raised against the middle region of CHRNA5
Cross Reactivity Human,Dog
Applications WB
Immunogen CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS
Assay Information CHRNA5 Blocking Peptide, catalog no. 33R-1967, is also available for use as a blocking control in assays to test for specificity of this CHRNA5 antibody

Images

Western Blot analysis using CHRNA5 antibody (70R-1529)

CHRNA5 antibody (70R-1529) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CHRNA5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CHRNA5 antibody (70R-1529) | CHRNA5 antibody (70R-1529) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors