CHRNA7 antibody (70R-1540)

Rabbit polyclonal CHRNA7 antibody raised against the middle region of CHRNA7

Synonyms Polyclonal CHRNA7 antibody, Anti-CHRNA7 antibody, Cholinergic Receptor Nicotinic Alpha 7 antibody
Specificity CHRNA7 antibody was raised against the middle region of CHRNA7
Cross Reactivity Human
Applications WB
Immunogen CHRNA7 antibody was raised using the middle region of CHRNA7 corresponding to a region with amino acids VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF
Assay Information CHRNA7 Blocking Peptide, catalog no. 33R-9739, is also available for use as a blocking control in assays to test for specificity of this CHRNA7 antibody


Western Blot analysis using CHRNA7 antibody (70R-1540)

CHRNA7 antibody (70R-1540) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CHRNA7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by CHRNA7 displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CHRNA7 antibody (70R-1540) | CHRNA7 antibody (70R-1540) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors