CHST13 antibody (70R-7171)

Rabbit polyclonal CHST13 antibody

Synonyms Polyclonal CHST13 antibody, Anti-CHST13 antibody, MGC119281 antibody, Chondroitin 4 Sulfotransferase 13 antibody, Carbohydrate antibody, MGC119278 antibody, C4ST3 antibody, MGC119279 antibody
Cross Reactivity Human
Applications WB
Immunogen CHST13 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRR
Assay Information CHST13 Blocking Peptide, catalog no. 33R-1336, is also available for use as a blocking control in assays to test for specificity of this CHST13 antibody

Images

Western Blot analysis using CHST13 antibody (70R-7171)

CHST13 antibody (70R-7171) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHST13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHST13 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CHST13 antibody (70R-7171) | CHST13 antibody (70R-7171) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors