CHST6 antibody (70R-5372)

Rabbit polyclonal CHST6 antibody

Synonyms Polyclonal CHST6 antibody, Anti-CHST6 antibody, Carbohydrate antibody, MCDC1 antibody, N-Acetylglucosamine 6-O Sulfotransferase 6 antibody
Cross Reactivity Human
Applications WB
Immunogen CHST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN
Assay Information CHST6 Blocking Peptide, catalog no. 33R-7529, is also available for use as a blocking control in assays to test for specificity of this CHST6 antibody


Western Blot analysis using CHST6 antibody (70R-5372)

CHST6 antibody (70R-5372) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHST6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHST6 catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues of keratan. It mediates sulfation of keratan in cornea. Keratan sulfate plays a central role in maintaining corneal transparency. CHST6 acts on the non-reducing terminal GlcNAc of short and long carbohydrate substrates that have poly-N-acetyllactosamine structures.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CHST6 antibody (70R-5372) | CHST6 antibody (70R-5372) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors