Chymotrypsin C antibody (70R-5465)

Rabbit polyclonal Chymotrypsin C antibody

Synonyms Polyclonal Chymotrypsin C antibody, Anti-Chymotrypsin C antibody, Caldecrin antibody, CTRC antibody, CLCR antibody, ELA4 antibody
Cross Reactivity Human
Applications WB
Immunogen Chymotrypsin C antibody was raised using a synthetic peptide corresponding to a region with amino acids LGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLK
Assay Information Chymotrypsin C Blocking Peptide, catalog no. 33R-4977, is also available for use as a blocking control in assays to test for specificity of this Chymotrypsin C antibody

Images

Western Blot analysis using Chymotrypsin C antibody (70R-5465)

Chymotrypsin C antibody (70R-5465) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CTRC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CTRC is a member of the peptidase S1 family. The protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. This gene encodes a member of the peptidase S1 family. The encoded protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Chymotrypsin C antibody (70R-5465) | Chymotrypsin C antibody (70R-5465) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors