Chymotrypsinogen B1 antibody (70R-7495)

Rabbit polyclonal Chymotrypsinogen B1 antibody raised against the middle region of CTRB1

Synonyms Polyclonal Chymotrypsinogen B1 antibody, Anti-Chymotrypsinogen B1 antibody, FLJ42412 antibody, MGC88037 antibody, CTRB antibody, CTRB1 antibody
Specificity Chymotrypsinogen B1 antibody was raised against the middle region of CTRB1
Cross Reactivity Human
Applications WB
Immunogen Chymotrypsinogen B1 antibody was raised using the middle region of CTRB1 corresponding to a region with amino acids VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
Assay Information Chymotrypsinogen B1 Blocking Peptide, catalog no. 33R-9835, is also available for use as a blocking control in assays to test for specificity of this Chymotrypsinogen B1 antibody


Western Blot analysis using Chymotrypsinogen B1 antibody (70R-7495)

Chymotrypsinogen B1 antibody (70R-7495) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CTRB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Alpha-chymotrypsin (EC is one of a family of serine proteases secreted into the gastrointestinal tract as the inactive precursor chymotrypsinogen. The zymogen is activated by proteolytic cleavage by trypsin.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Chymotrypsinogen B1 antibody (70R-7495) | Chymotrypsinogen B1 antibody (70R-7495) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors