CISD2 antibody (70R-6583)

Rabbit polyclonal CISD2 antibody raised against the N terminal of CISD2

Synonyms Polyclonal CISD2 antibody, Anti-CISD2 antibody, Miner1 antibody, CISD-2, CISD2, CISD 2, Cdgsh Iron Sulfur Domain 2 antibody, ZCD2 antibody, CISD-2 antibody, WFS2 antibody, CISD 2 antibody, ERIS antibody
Specificity CISD2 antibody was raised against the N terminal of CISD2
Cross Reactivity Human
Applications WB
Immunogen CISD2 antibody was raised using the N terminal of CISD2 corresponding to a region with amino acids VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALL
Assay Information CISD2 Blocking Peptide, catalog no. 33R-9652, is also available for use as a blocking control in assays to test for specificity of this CISD2 antibody

Images

Western Blot analysis using CISD2 antibody (70R-6583)

CISD2 antibody (70R-6583) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CISD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CISD2 is a zinc finger protein that localizes to the endoplasmic reticulum. It binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2 (WFS2).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CISD2 antibody (70R-6583) | CISD2 antibody (70R-6583) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors