CK1 delta antibody (70R-2089)

Rabbit polyclonal CK1 delta antibody raised against the middle region of CSNK1D

Synonyms Polyclonal CK1 delta antibody, Anti-CK1 delta antibody, Casein Kinase 1 Delta antibody, CK-1 antibody, HCKID antibody, CK 1 antibody, CK 1, CSNK1D antibody, CK1, CK-1, CK1A1 antibody
Specificity CK1 delta antibody was raised against the middle region of CSNK1D
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen CK1 delta antibody was raised using the middle region of CSNK1D corresponding to a region with amino acids NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR
Assay Information CK1 delta Blocking Peptide, catalog no. 33R-6786, is also available for use as a blocking control in assays to test for specificity of this CK1 delta antibody

Images

Western Blot analysis using CK1 delta antibody (70R-2089)

Western Blot showing CK1 delta antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSNK1D antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.2-1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the casein kinase I (CKI) gene family whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CK1 delta antibody (70R-2089) | Western Blot showing CK1 delta antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors