CK1 gamma 2 antibody (70R-3493)

Rabbit polyclonal CK1 gamma 2 antibody raised against the N terminal of CSNK1G2

Synonyms Polyclonal CK1 gamma 2 antibody, Anti-CK1 gamma 2 antibody, CK-1, CK1E antibody, Casein Kinase 1 Gamma 2 antibody, CK1, CK 1 antibody, CK 1, CK1g2 antibody, CSNK1G2 antibody, CK-1 antibody
Specificity CK1 gamma 2 antibody was raised against the N terminal of CSNK1G2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CK1 gamma 2 antibody was raised using the N terminal of CSNK1G2 corresponding to a region with amino acids FDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTK
Assay Information CK1 gamma 2 Blocking Peptide, catalog no. 33R-2867, is also available for use as a blocking control in assays to test for specificity of this CK1 gamma 2 antibody

Images

Western Blot analysis using CK1 gamma 2 antibody (70R-3493)

CK1 gamma 2 antibody (70R-3493) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSNK1G2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CSNK1G2 belongs to the protein kinase superfamily, CK1 Ser/Thr protein kinase family, casein kinase I subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. It participates in Wnt signaling.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CK1 gamma 2 antibody (70R-3493) | CK1 gamma 2 antibody (70R-3493) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors