CK1 gamma 3 antibody (70R-3674)

Rabbit polyclonal CK1 gamma 3 antibody raised against the middle region of CSNK1G3

Synonyms Polyclonal CK1 gamma 3 antibody, Anti-CK1 gamma 3 antibody, CK 1, CK1, Casein Kinase 1 Gamma 3 antibody, CK1G2 antibody, CK-1 antibody, CK-1, CSNK1G3 antibody, CK 1 antibody
Specificity CK1 gamma 3 antibody was raised against the middle region of CSNK1G3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CK1 gamma 3 antibody was raised using the middle region of CSNK1G3 corresponding to a region with amino acids LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP
Assay Information CK1 gamma 3 Blocking Peptide, catalog no. 33R-4875, is also available for use as a blocking control in assays to test for specificity of this CK1 gamma 3 antibody

Images

Western Blot analysis using CK1 gamma 3 antibody (70R-3674)

CK1 gamma 3 antibody (70R-3674) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSNK1G3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1G3 can phosphorylate a large number of proteins. It participates in Wnt signaling.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CK1 gamma 3 antibody (70R-3674) | CK1 gamma 3 antibody (70R-3674) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors